PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT2G21230.1
Common NameBZIP30
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 519aa    MW: 56326.4 Da    PI: 8.7649
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT2G21230.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.42.2e-11372430563
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  kr +r   NR++A rs +RK  +++eLe kv++L++e ++L  +l +l+  +  l++++
  AT2G21230.1 372 KRVKRILANRVSAARSKERKTRYMAELEHKVQTLQTEATTLSAQLTHLQRDSMGLTNQN 430
                  899*********************************************99888777766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.8E-19368432IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.749370433IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.62E-11372428No hitNo description
PfamPF001701.1E-9372429IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.2E-12372426No hitNo description
CDDcd147031.68E-21373422No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0010628Biological Processpositive regulation of gene expression
GO:0010629Biological Processnegative regulation of gene expression
GO:0090567Biological Processreproductive shoot system development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000005anatomycultured plant cell
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 519 aa     Download sequence    Send to blast
MGGGGDTTDT NMMQRVNSSS GTSSSSIPKH NLHLNPALIR SHHHFRHPFT GAPPPPIPPI  60
SPYSQIPATL QPRHSRSMSQ PSSFFSFDSL PPLNPSAPSV SVSVEEKTGA GFSPSLPPSP  120
FTMCHSSSSR NAGDGENLPP RKSHRRSNSD VTFGFSSMMS QNQKSPPLSS LERSISGEDT  180
SDWSNLVKKE PREGFYKGRK PEVEAAMDDV FTAYMNLDNI DVLNSFGGED GKNGNENVEE  240
MESSRGSGTK KTNGGSSSDS EGDSSASGNV KVALSSSSSG VKRRAGGDIA PTGRHYRSVS  300
MDSCFMGKLN FGDESSLKLP PSSSAKVSPT NSGEGNSSAY SVEFGNSEFT AAEMKKIAAD  360
EKLAEIVMAD PKRVKRILAN RVSAARSKER KTRYMAELEH KVQTLQTEAT TLSAQLTHLQ  420
RDSMGLTNQN SELKFRLQAM EQQAQLRDAL SEKLNEEVQR LKLVIGEPNR RQSGSSSSES  480
KMSLNPEMFQ QLSISQLQHQ QMQHSNQCST MKAKHTSND
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.228730.0floral meristem| flower| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible263414_at0.0
Expression AtlasAT2G21230-
AtGenExpressAT2G21230-
ATTED-IIAT2G21230-
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00037PBM25215497Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT2G21230.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G43700
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT2G21230
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4012980.0AF401298.1 Arabidopsis thaliana transcription factor bZIP30 (BZIP30) mRNA, complete cds.
GenBankAY0544970.0AY054497.1 Arabidopsis thaliana putative bZIP transcription factor (At2g21230; F7O24.5) mRNA, complete cds.
GenBankAY0932680.0AY093268.1 Arabidopsis thaliana putative bZIP transcription factor (At2g21230) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_179719.10.0Basic-leucine zipper (bZIP) transcription factor family protein
TrEMBLQ9SIG80.0Q9SIG8_ARATH; Basic-leucine zipper (BZIP) transcription factor family protein
STRINGAT2G21230.30.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  3. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  4. Satoh R,Fujita Y,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K
    A novel subgroup of bZIP proteins functions as transcriptional activators in hypoosmolarity-responsive expression of the ProDH gene in Arabidopsis.
    Plant Cell Physiol., 2004. 45(3): p. 309-17
    [PMID:15047879]
  5. Deppmann CD, et al.
    Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs.
    Nucleic Acids Res., 2004. 32(11): p. 3435-45
    [PMID:15226410]
  6. Deppmann CD,Alvania RS,Taparowsky EJ
    Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks.
    Mol. Biol. Evol., 2006. 23(8): p. 1480-92
    [PMID:16731568]
  7. Cheng C, et al.
    An early response regulatory cluster induced by low temperature and hydrogen peroxide in seedlings of chilling-tolerant japonica rice.
    BMC Genomics, 2007. 8: p. 175
    [PMID:17577400]
  8. Jones AM, et al.
    Phosphoproteomic analysis of nuclei-enriched fractions from Arabidopsis thaliana.
    J Proteomics, 2009. 72(3): p. 439-51
    [PMID:19245862]
  9. Reiland S, et al.
    Large-scale Arabidopsis phosphoproteome profiling reveals novel chloroplast kinase substrates and phosphorylation networks.
    Plant Physiol., 2009. 150(2): p. 889-903
    [PMID:19376835]
  10. Kline KG,Barrett-Wilt GA,Sussman MR
    In planta changes in protein phosphorylation induced by the plant hormone abscisic acid.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(36): p. 15986-91
    [PMID:20733066]
  11. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  12. Chen J, et al.
    Uncovering Arabidopsis membrane protein interactome enriched in transporters using mating-based split ubiquitin assays and classification models.
    Front Plant Sci, 2012. 3: p. 124
    [PMID:22737156]
  13. Efroni I, et al.
    Regulation of leaf maturation by chromatin-mediated modulation of cytokinin responses.
    Dev. Cell, 2013. 24(4): p. 438-45
    [PMID:23449474]
  14. Jones AM, et al.
    Border control--a membrane-linked interactome of Arabidopsis.
    Science, 2014. 344(6185): p. 711-6
    [PMID:24833385]
  15. Tsugama D,Liu S,Takano T
    Analysis of functions of VIP1 and its close homologs in osmosensory responses of Arabidopsis thaliana.
    PLoS ONE, 2014. 9(8): p. e103930
    [PMID:25093810]